PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016507340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 350aa    MW: 39268.9 Da    PI: 6.1075
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016507340.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-1369110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T++E+el++++++  G++ W+ Ia+ ++ gRt++++ks w++
   XP_016507340.1  69 SFTPQEEELIIKLHATIGSR-WSIIAQQIP-GRTDNEVKSLWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.61463IPR001005SANT/Myb domain
SuperFamilySSF466891.87E-1814108IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-112068IPR009057Homeodomain-like
PROSITE profilePS500906.0632061IPR017877Myb-like domain
PROSITE profilePS5129418.47162116IPR017930Myb domain
SMARTSM007176.9E-1166114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-2069116IPR009057Homeodomain-like
PfamPF002492.0E-1269110IPR001005SANT/Myb domain
CDDcd001673.36E-869112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGRPPCCSDK MHNRRCNWTE EDANTSTFVS KHGIGNWTAM SKKSGTGKCG RGQKNRWSNR  60
LKTDLKEDSF TPQEEELIIK LHATIGSRWS IIAQQIPGRT DNEVKSLWNT KLKKKLSAMG  120
IDPVTHKPFS QILTDYGNIG GFPKARTRFV SLNRELKGAF MSTPEQLQHP LERFPNFNSH  180
CVTTIRLQKT ETSEDCFLSN NYDCSNNQPP VDLLSELQAI QFVTEASNNN SPKAIFSYTN  240
PITDCSLSSP LSSSSSSSAS HSLTKNHVNW CDYLLDDAFQ EDTLNIEEKL VSGAAQEYRQ  300
NNAPTMEDFE ATLSIKVTSP SSSSSFVEAM LECENEMFLN FPGLSEDPFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-201811610108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009800479.10.0PREDICTED: myb-related protein 315-like
RefseqXP_016507340.10.0PREDICTED: transcription factor MYB35-like
TrEMBLK4BKK50.0K4BKK5_SOLLC; Uncharacterized protein
STRINGSolyc03g113530.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA123481922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.17e-51MYB family protein